Website-Überblick
animatedfilmreviews.filminspector.com

animatedfilmreviews.filminspector.com

Hier findest du die wichtigsten Informationen, die wir über animatedfilmreviews.filminspector.com in unserem System gesammelt haben. Wir hoffen, wir können dir damit weiterhelfen, das Internet und seinen Aufbau besser zu verstehen...

Sicherheit und Einstufung

Die Website enthält laut CLOUDFLARE keine bedenklichen Inhalte und kann sowohl von Minderjährigen als auch in der Arbeit genutzt werden.
Stand: 16.04.2025 11:16:32

Technologien:

  • AMP

    AMP, originally created by Google, is an open-source HTML framework developed by the AMP open-source Project. AMP is designed to help webpages load faster.

  • Blogger

    Blogger is a blog-publishing service that allows multi-user blogs with time-stamped entries.

  • Cloudflare

    Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

  • Google AdSense

    Google AdSense is a program run by Google through which website publishers serve advertisements that are targeted to the site content and audience.

  • Google Analytics

    Google Analytics is a free web analytics service that tracks and reports website traffic.

  • HTTP/3

    HTTP/3 is the third major version of the Hypertext Transfer Protocol used to exchange information on the World Wide Web.

  • Open Graph

    Open Graph is a protocol that is used to integrate any web page into the social graph.

  • YouTube

    YouTube is a video sharing service where users can create their own profile, upload videos, watch, like and comment on other videos.