Website-Überblick
norwichcityfcalandvalwemeetagain.buzzsprout.com

norwichcityfcalandvalwemeetagain.buzzsprout.com

Hier findest du die wichtigsten Informationen, die wir über norwichcityfcalandvalwemeetagain.buzzsprout.com in unserem System gesammelt haben. Wir hoffen, wir können dir damit weiterhelfen, das Internet und seinen Aufbau besser zu verstehen...

Sicherheit und Einstufung

Die Website enthält laut CLOUDFLARE keine bedenklichen Inhalte und kann sowohl von Minderjährigen als auch in der Arbeit genutzt werden.
Stand: 16.04.2025 17:53:58

Technologien:

  • Cloudflare

    Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

  • HSTS

    HTTP Strict Transport Security (HSTS) informs browsers that the site should only be accessed using HTTPS.

  • Open Graph

    Open Graph is a protocol that is used to integrate any web page into the social graph.

  • Ruby on Rails

    Ruby on Rails is a server-side web application framework written in Ruby under the MIT License.

  • Stimulus

    A modest JavaScript framework for the HTML you already have.