Website-Überblick
peisleystreetflamegrilledchicken.com.au

peisleystreetflamegrilledchicken.com.au

Hier findest du die wichtigsten Informationen, die wir über peisleystreetflamegrilledchicken.com.au in unserem System gesammelt haben. Wir hoffen, wir können dir damit weiterhelfen, das Internet und seinen Aufbau besser zu verstehen...

Sicherheit und Einstufung

Die Website enthält laut CLOUDFLARE keine bedenklichen Inhalte und kann sowohl von Minderjährigen als auch in der Arbeit genutzt werden.
Stand: 18.04.2025 00:39:21

Technologien:

  • Amazon CloudFront

    Amazon CloudFront is a fast content delivery network (CDN) service that securely delivers data, videos, applications, and APIs to customers globally with low latency, high transfer speeds.

  • Cloudflare

    Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

  • Google Maps

    Google Maps is a web mapping service. It offers satellite imagery, aerial photography, street maps, 360° interactive panoramic views of streets, real-time traffic conditions, and route planning for traveling by foot, car, bicycle and air, or public transportation.

  • HSTS

    HTTP Strict Transport Security (HSTS) informs browsers that the site should only be accessed using HTTPS.

  • HTTP/3

    HTTP/3 is the third major version of the Hypertext Transfer Protocol used to exchange information on the World Wide Web.

  • React

    React is an open-source JavaScript library for building user interfaces or UI components.