Website-Überblick
roxwayseptictankcleaningservices.beauty

roxwayseptictankcleaningservices.beauty

Hier findest du die wichtigsten Informationen, die wir über roxwayseptictankcleaningservices.beauty in unserem System gesammelt haben. Wir hoffen, wir können dir damit weiterhelfen, das Internet und seinen Aufbau besser zu verstehen...

Sicherheit und Einstufung

Die Website enthält laut CLOUDFLARE keine bedenklichen Inhalte und kann sowohl von Minderjährigen als auch in der Arbeit genutzt werden.
Stand: 18.04.2025 01:56:30

Technologien:

  • Cloudflare

    Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

  • Hostinger Website Builder

    Hostinger Website Builder is a web-based platform that allows users to create and design websites without needing to write code or have extensive technical knowledge.

  • Hostinger

    Hostinger is an employee-owned Web hosting provider and internet domain registrar.

  • HSTS

    HTTP Strict Transport Security (HSTS) informs browsers that the site should only be accessed using HTTPS.

  • HTTP/3

    HTTP/3 is the third major version of the Hypertext Transfer Protocol used to exchange information on the World Wide Web.

  • Open Graph

    Open Graph is a protocol that is used to integrate any web page into the social graph.

  • OpenResty

    OpenResty is a web platform based on nginx which can run Lua scripts using its LuaJIT engine.

  • Vue.js

    Vue.js is an open-source model–view–viewmodel JavaScript framework for building user interfaces and single-page applications.