Website-Überblick
wishartvillagefamilypractice.com.au

wishartvillagefamilypractice.com.au

Hier findest du die wichtigsten Informationen, die wir über wishartvillagefamilypractice.com.au in unserem System gesammelt haben. Wir hoffen, wir können dir damit weiterhelfen, das Internet und seinen Aufbau besser zu verstehen...

Sicherheit und Einstufung

Die Website enthält laut CLOUDFLARE keine bedenklichen Inhalte und kann sowohl von Minderjährigen als auch in der Arbeit genutzt werden.
Stand: 17.04.2025 23:23:36

Technologien:

  • Cloudflare

    Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

  • Divi

    Divi is a WordPress Theme and standalone WordPress plugin from Elegant themes that allows users to build websites using the visual drag-and-drop Divi page builder.

  • GoDaddy CoBlocks

    GoDaddy CoBlocks is a suite of professional page building content blocks for the WordPress Gutenberg block editor.

  • HSTS

    HTTP Strict Transport Security (HSTS) informs browsers that the site should only be accessed using HTTPS.

  • HTTP/3

    HTTP/3 is the third major version of the Hypertext Transfer Protocol used to exchange information on the World Wide Web.

  • jQuery Migrate

    Query Migrate is a javascript library that allows you to preserve the compatibility of your jQuery code developed for versions of jQuery older than 1.9.

  • jQuery

    jQuery is a JavaScript library which is a free, open-source software designed to simplify HTML DOM tree traversal and manipulation, as well as event handling, CSS animation, and Ajax.

  • Priority Hints

    Priority Hints exposes a mechanism for developers to signal a relative priority for browsers to consider when fetching resources.

  • Swiper

    Swiper is a JavaScript library that creates modern touch sliders with hardware-accelerated transitions.

  • WordPress

    WordPress is a free and open-source content management system written in PHP and paired with a MySQL or MariaDB database. Features include a plugin architecture and a template system.